PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0070s0078.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YA
Protein Properties Length: 320aa    MW: 35000.2 Da    PI: 9.7063
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0070s0078.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA90.32.5e-28153209158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          d p++VNaKQy++I++RR  Rak+e  kk  + +rkpy+heSRh hA+rR Rg+gGrF
  Kalax.0070s0078.2.p 153 DGPIFVNAKQYHGIIRRRLYRAKAELVKKS-IGARKPYMHESRHLHAVRRVRGCGGRF 209
                          57************************9999.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.7E-31151212IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115231.797152212IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.3E-21155177IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-24155209IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860157177IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.3E-21186209IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MQTVYLKEYE GMSEKTIGHL SSGQTMPWWA AESHSDPTEA FRHLKSSPVE HATAGRQFTL  60
TKSDHSRTLK GAEKAAANQF TISPGGQRTQ QVQASVNIQP TLSDYDTHLE PGYGQAMVNP  120
KYPYGDQSFW AMSTYGPQVQ GRVMLPQNST ADDGPIFVNA KQYHGIIRRR LYRAKAELVK  180
KSIGARKPYM HESRHLHAVR RVRGCGGRFL NTKVSDAGTG RNSMKFASDA ILSQPTDSPS  240
SGIFQSDSGT LNSPKQANSD MSNISVSEAT SVYTRGDLRC WTTNFLGPSI PAMMDTRHGM  300
IAAPSHWVAA AQNCCNPNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A3e-14153210260HAPB protein
4g91_A3e-14153210260HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008387119.16e-98PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLF6I3K74e-96F6I3K7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0032g01190.t011e-95(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-44nuclear factor Y, subunit A10